PrototypeCommon
cedws/apple-telemetry
Domain blocklists, IP blocklists, Little Snitch .lsrules, and cloaking files for blocking Apple telemetry
Archived: this repository is read-only
- Owner
- cedws (personal account)
- Stars
- Stars: 223
- Forks
- Forks: 19
- Language
- Python
- License
- GPL-3.0
- Created
- 2018
- Topics
- blocklistsprivacytelemetryapplelittle-snitch
- Tier
- Prototype (100 to 249 ★) What this tier means
More repos by cedws
All 2 repos by cedws- cedws/discord-deleteStars: 121GoPrototype
Nearby in Python
All Python repos- zju3dv/SuperNavStars: 223PythonPrototype
- Cattmonkey/ChaosIntelligenceStars: 223PythonPrototype
- wquguru/shiseiStars: 223PythonPrototype
- qgriffith-zz/OpenEatsStars: 223PythonPrototype
- aewallin/openvoronoiStars: 223PythonPrototype
- janosgyerik/bashonelinersStars: 223PythonPrototype